PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009610187.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 740aa    MW: 80566.7 Da    PI: 6.5487
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009610187.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.79.8e-33323380260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  XP_009610187.1 323 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSH-EGHITEIIYKGAHNHPK 380
                     8****************************************.***************85 PP

2WRKY104.17.5e-33537595159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  XP_009610187.1 537 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERASHDLKSVITTYEGKHNHD 595
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-29320381IPR003657WRKY domain
SuperFamilySSF1182909.42E-26321381IPR003657WRKY domain
SMARTSM007749.0E-37322380IPR003657WRKY domain
PfamPF031063.0E-25323379IPR003657WRKY domain
PROSITE profilePS5081123.399323381IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.4E-37522597IPR003657WRKY domain
SuperFamilySSF1182901.57E-28529597IPR003657WRKY domain
PROSITE profilePS5081138.733532597IPR003657WRKY domain
SMARTSM007746.6E-38537596IPR003657WRKY domain
PfamPF031065.1E-25538595IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MLYVQCPQLM GGFDDHVAIM GDWMPPSPSP RSFFSSLLGD DIGSRSTFEF PNENQRGNLA  60
SEPQEHVGIS DGAQADATTV KSDQKMSSRG GLLERMAARA GFNAPKLNTE SLRPADLSQN  120
QGVRSPYLTI PPGLSPTSLL ESPVFLSNSL VQPSPTTGKF QFASGIESRN STFMMEDPDK  180
RKENALESIN SSSFSFKPVP ETAPSLFPGT TSRSWLQVNS SNISQQCFPN IKVSVHSQNS  240
LLSHSVEATQ MQTQSEKGLH QSSDFPRFSA EKGVRDSNVT PESRNFQSVG SNMEHSPPLD  300
EPQDEEIDQR VGGDPNVVGA PAEDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE  360
RSHEGHITEI IYKGAHNHPK PPPNRRSALG STNSLGELQL DGAEQGVSGS NGDLGRANIQ  420
KAPDAGGLDW RNNNLDVTSS AHLGSAYCNG SASFPVQNNT QLESGGAVDV SSTFSNDEDE  480
DDRGTHGSVS QGYDGEGDES ESKRRKLETY STDMSGATRA IREPRVVVQT TSEVDILDDG  540
YRWRKYGQKV VKGNPNPRSY YKCTSAGCNV RKHVERASHD LKSVITTYEG KHNHDVPAAR  600
NSSHVNSGAS NTLPAPVTAP PAQSHLHRPE PAQLQNAMAR FDRQPSLGSF GPTPGYSYGI  660
NQQGLASLAM AGFHPNQSKS QQQIPVHSYL GQPRPMHDGG FMFPKEEPKA EPMSDPGLDL  720
SNGSSIYQQF MSRLPLGPQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-37323598878Probable WRKY transcription factor 4
2lex_A6e-37323598878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0635760.0AB063576.1 Nicotiana tabacum NtWRKY-9 mRNA for WRKY DNA-binding protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610187.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
RefseqXP_016456273.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLQ94IB30.0Q94IB3_TOBAC; WRKY DNA-binding protein
STRINGPGSC0003DMT4000569520.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37112341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-178WRKY DNA-binding protein 2